PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA02G0218900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 89aa    MW: 10189.7 Da    PI: 9.9316
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA02G0218900.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.4e-161562148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEd++l d++ ++G g+W++ +++ g+ R +k+c++rw +yl
  ORGLA02G0218900.1 15 KGLWSPEEDQKLRDYILRHGHGCWSALPAKAGLQRNGKSCRLRWINYL 62
                       678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.2541066IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-221064IPR009057Homeodomain-like
SMARTSM007175.3E-111464IPR001005SANT/Myb domain
PfamPF002499.8E-151562IPR001005SANT/Myb domain
SuperFamilySSF466895.7E-211789IPR009057Homeodomain-like
CDDcd001676.13E-101862No hitNo description
Gene3DG3DSA:1.10.10.601.4E-76589IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MGCKSCEKPR PNYRKGLWSP EEDQKLRDYI LRHGHGCWSA LPAKAGLQRN GKSCRLRWIN  60
YLRPGLKHGV FSPEEEETVM SLHAALGNK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8372491e-146EU837249.1 Oryza sativa Japonica Group clone KCS157B05 ATMYB4-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015689021.17e-61PREDICTED: myb-related protein 308
SwissprotQ9M0K41e-38LAF1_ARATH; Transcription factor LAF1
TrEMBLI1P2I32e-61I1P2I3_ORYGL; Uncharacterized protein
TrEMBLA0A0E0CP035e-61A0A0E0CP03_9ORYZ; Uncharacterized protein
STRINGORGLA02G0218900.15e-61(Oryza glaberrima)
STRINGBGIOSGA008698-PA2e-60(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.17e-40myb domain protein 18